PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.E01606.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family NF-YB
Protein Properties Length: 180aa    MW: 20228.8 Da    PI: 8.4769
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.E01606.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB1283.3e-4031122293
             NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrel 93 
                       r+ d++ Pian++ri+++vlP++aki++dake +qecvsefisf+t+ea+ +c+++ r t++++d+l a+a+lGf+dy+e+l+v+l+++r  
  Migut.E01606.1.p  31 RDADEYKPIANITRILRRVLPTHAKIADDAKEAIQECVSEFISFITAEANRRCRHDYRTTVKPEDVLAAMASLGFDDYLESLTVFLNNHRMQ 122
                       7899***********************************************************************************99964 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.4E-3824132IPR009072Histone-fold
SuperFamilySSF471134.97E-3138134IPR009072Histone-fold
PfamPF008081.5E-2038100IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006154.5E-126482No hitNo description
PRINTSPR006154.5E-1283101No hitNo description
PRINTSPR006154.5E-12102120No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 180 aa     Download sequence    Send to blast
MEKGGSSNIE YKYTRRARTS EVNQEQQGFK RDADEYKPIA NITRILRRVL PTHAKIADDA  60
KEAIQECVSE FISFITAEAN RRCRHDYRTT VKPEDVLAAM ASLGFDDYLE SLTVFLNNHR  120
MQQDPERGSR DQLSQFVRRD GGVGVGFLHQ QPQGAPNNGV LRPLTSTCCC YGGKRGMVL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B6e-3231120291Transcription factor HapC (Eurofung)
4g92_B6e-3231120291Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012846296.11e-117PREDICTED: nuclear transcription factor Y subunit B-1-like
SwissprotQ9SFD81e-41NFYB9_ARATH; Nuclear transcription factor Y subunit B-9
TrEMBLA0A022QQR21e-112A0A022QQR2_ERYGU; Uncharacterized protein (Fragment)
STRINGscaffold_102469.12e-40(Arabidopsis lyrata)
STRINGscaffold_102467.12e-40(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA6044436
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21970.15e-40NF-YB family protein